PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g11676.2.p
Common NameBRADI_2g11676, LOC100828073
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 393aa    MW: 42773.4 Da    PI: 5.1719
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g11676.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.51.3e-171461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      rgrWT eEd++l++++k++G g+W++ ++  g+ R++k+c++rw +yl
  Bradi2g11676.2.p 14 RGRWTREEDDILAKYIKEHGEGSWRSMPKNAGLLRCGKSCRLRWINYL 61
                      8*******************************99************97 PP

2Myb_DNA-binding54.13.7e-1767112148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       rg+ ++eE+e ++++++ lG++ W++Ia +++ gRt++++k++w+++l
  Bradi2g11676.2.p  67 RGNISEEEEEMIIKLHATLGNR-WSLIAGHLP-GRTDNEIKNYWNSHL 112
                       7899******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.1E-23564IPR009057Homeodomain-like
PROSITE profilePS5129416.741961IPR017930Myb domain
SuperFamilySSF466891.43E-2811108IPR009057Homeodomain-like
SMARTSM007172.8E-131363IPR001005SANT/Myb domain
PfamPF002497.6E-161461IPR001005SANT/Myb domain
CDDcd001674.94E-111661No hitNo description
PROSITE profilePS5129425.24962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.4E-2565115IPR009057Homeodomain-like
SMARTSM007174.4E-1766114IPR001005SANT/Myb domain
PfamPF002492.4E-1567112IPR001005SANT/Myb domain
CDDcd001671.38E-877112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 393 aa     Download sequence    Send to blast
MGRAPCCEKV GLKRGRWTRE EDDILAKYIK EHGEGSWRSM PKNAGLLRCG KSCRLRWINY  60
LRADLKRGNI SEEEEEMIIK LHATLGNRWS LIAGHLPGRT DNEIKNYWNS HLSRRSHDFP  120
KGGDGVVVNV DLSKLPGGGK RRGGRVGRAT ATTAKGKRKA RGKKAGKVKK DKVAEMEHHH  180
HHHKEDATDE EAMNSISTPS SCHSGSARGG EEQAQASASG VTSDGFDEAP LGLCEEMVSG  240
LKAQPSPHTE VGQDVSGNEG ESAPEKTVRH EELSSSKAAV VEQDQHGCCN EGECGTSGPA  300
KVMGQEELGD KAMDCDHNGC CDKEESEPAE AVGLEEPVDD KAMEWDLVGL DDSLPTDDMW  360
GSLVWDYDDM VISDGGQQQE SVLSDLFFLD NI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-23121155107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0927671e-112FP092767.1 Phyllostachys edulis cDNA clone: bphylf059d01, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003565704.10.0PREDICTED: myb-related protein P-like
TrEMBLI1HEV80.0I1HEV8_BRADI; Uncharacterized protein
STRINGBRADI2G11676.10.0(Brachypodium distachyon)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47460.12e-71myb domain protein 12